LOC645015 (N-Term) anticorps

N° du produit ABIN631428

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans WB. Adapté pour Humain.

Aperçu rapide pour LOC645015 (N-Term) anticorps (ABIN631428)

Antigène: LOC645015

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: LOC645015 antibody was raised against the N terminal of LOC645015

Purification: Affinity purified

Immunogène: LOC645015 antibody was raised using the N terminal of LOC645015 corresponding to a region with amino acids HLCGTLACRPPSICCMLLTSRVATQTAIQTYQENPQASPEVPVLLGPCEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC645015 Blocking Peptide, (ABIN939159), is also available for use as a blocking control in assays to test for specificity of this LOC645015 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC645015 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: LOC645015

Sujet: The function of LOC645015 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)